Review



recombinant human il 17  (R&D Systems)


Bioz Verified Symbol R&D Systems is a verified supplier
Bioz Manufacturer Symbol R&D Systems manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 93
      Buy from Supplier

    Structured Review

    R&D Systems recombinant human il 17
    Recombinant Human Il 17, supplied by R&D Systems, used in various techniques. Bioz Stars score: 93/100, based on 55 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/Recombinant+Human+IL-17A+(Human+Cell-expressed)+Protein/10__17161_slash_sjm__v2i4__24358-34-2-10
    Average 93 stars, based on 55 article reviews
    recombinant human il 17 - by Bioz Stars, 2026-09
    93/100 stars

    Images

    Related Articles

    Recombinant:

    Article Title: Interactions Between IL-17 Variants and Streptococcus in the Gut Contribute to the Development of Atopic Dermatitis in Infancy
    Article Snippet: .. Recombinant human IL-17 (R&D Systems, Lille, France) was resuspended in sterile PBS. ..

    Article Title: Impaired Langerhans cell migration in psoriasis is due to an altered keratinocyte phenotype induced by interleukin-17.
    Article Snippet: .. In some experiments KC received addition of 100 ng/ml recombinant human IL-17 (R&D systems), or bovine serum albumin (BSA) vehicle control (Sigma). ..

    Article Title: Interleukin-17 plays a role in pulp inflammation partly by WNT5A protein induction.
    Article Snippet: Objective: Our study aimed to investigate the role of interleukin (IL)-17 in dental pulp inflammation and the relationship between WNT5A and IL-17.. Methods: Immunohistochemical staining was used to detect the expression of tumor necrosis factor-α (TNF-α), WNT5A and IL-17 in pulp tissues.. Anti-IL-17 neutralizing antibody was used in rat pulpitis model and to study the role of IL-17 on pulpitis.

    Article Title: Human IL-17 and TNF-α Additively or Synergistically Regulate the Expression of Proinflammatory Genes, Coagulation-Related Genes, and Tight Junction Genes in Porcine Aortic Endothelial Cells
    Article Snippet: .. Recombinant human IL-17, recombinant human TNFα, and recombinant porcine IFN-γ were purchased from R&D Systems (Minneapolis, MN, USA). .. Anti-actin antibody was purchased from Cell Signaling Technology (Boston, MA, USA), anti-occludin antibody was obtained from Thermo Fisher Scientific (Rockford, IL, USA), anti-FITC-labeled SLA class I antibody (SLA-I) was obtained from Bio-Rad (Hercules, CA, USA), and Cell Counting Kit-8 (CCK8) was purchased from Dojindo Laboratories (Kumamoto, Japan).

    Article Title: IL-17 and CD40 ligand synergistically stimulate the chronicity of diabetic nephropathy.
    Article Snippet: .. The cells were then incubated with CD40L (Biorbyt) and recombinant human IL-17 at 50 ng/mL (R&D Systems). .. Statistical analysis Statistical analysis was performed with commercially available SPSS 12.0 software (SPSS Inc., Chicago, IL, USA) with continuous variables.

    Article Title: Oral epithelial cells orchestrate innate type 17 responses to Candida albicans through the virulence factor candidalysin.
    Article Snippet: .. Recombinant human IL-17, TNF, and IL-22 (R&D Systems) were used at 200, 20, or 100 ng/ml, respectively. .. Candidalysin (SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK) was from Peptide Protein Research Ltd. Antibodies used were Phospho-IB and IB (Upstate Biotechnology), c-Fos and phospho-MKP1 (Cell Signaling), and Actin (clone C4, EMD Millipore).

    Article Title: Effects of Interleukin-17 on Expression of CD40 and CD40L in T and B Cell Lines
    Article Snippet: .. 2.2 Reagents Recombinant human IL-17 (cat# 7955-IL) was purchased from R&D Systems, Minneapolis, MN, USA. .. For protein detection, the following primary antibodies were used: rabbit monoclonal anti-CD40 (D8W3N) (cat# 40868T, Cell Signaling Technology, Danvers, MA, USA), rabbit polyclonal anti-CD40L (cat# A0327, ABclonal, Woburn, MA, USA), and mouse monoclonal anti- glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (cat# MAB374; MilliporeSigma, Burlington, MA, USA).

    Article Title: Immunoproteasome inhibition prevents progression of castration-resistant prostate cancer.
    Article Snippet: .. RPMI-1640 medium with vehicle (DMSO) or recombinant human IL-17 (20 ng/ml, R&D system) was placed in the upper chamber. ..

    Sterility:

    Article Title: Interactions Between IL-17 Variants and Streptococcus in the Gut Contribute to the Development of Atopic Dermatitis in Infancy
    Article Snippet: .. Recombinant human IL-17 (R&D Systems, Lille, France) was resuspended in sterile PBS. ..

    Control:

    Article Title: Impaired Langerhans cell migration in psoriasis is due to an altered keratinocyte phenotype induced by interleukin-17.
    Article Snippet: .. In some experiments KC received addition of 100 ng/ml recombinant human IL-17 (R&D systems), or bovine serum albumin (BSA) vehicle control (Sigma). ..

    Incubation:

    Article Title: IL-17 and CD40 ligand synergistically stimulate the chronicity of diabetic nephropathy.
    Article Snippet: .. The cells were then incubated with CD40L (Biorbyt) and recombinant human IL-17 at 50 ng/mL (R&D Systems). .. Statistical analysis Statistical analysis was performed with commercially available SPSS 12.0 software (SPSS Inc., Chicago, IL, USA) with continuous variables.



    Similar Products

    recombinant il 17  (MedChemExpress)
    94
    MedChemExpress recombinant il 17
    Recombinant Il 17, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/IL-17A%2C+Human/pm42340520-75-25-28
    Average 94 stars, based on 1 article reviews
    recombinant il 17 - by Bioz Stars, 2026-09
    94/100 stars
    		  Buy from Supplier
    il 17 group  (Proteintech)
    93
    Proteintech il 17 group
    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in <t>IL-17–stimulated</t> keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.
    Il 17 Group, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/Animal-free+Recombinant+Human+IL-17/pmc12951635-54-1-9
    Average 93 stars, based on 1 article reviews
    il 17 group - by Bioz Stars, 2026-09
    93/100 stars
    		  Buy from Supplier
    il 17  (Proteintech)
    93
    Proteintech il 17
    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in <t>IL-17–stimulated</t> keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.
    Il 17, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/Animal-free+Recombinant+Human+IL-17/pmc12951635-54-8-9
    Average 93 stars, based on 1 article reviews
    il 17 - by Bioz Stars, 2026-09
    93/100 stars
    		  Buy from Supplier
    recombinant human il 17a protein  (Proteintech)
    93
    Proteintech recombinant human il 17a protein
    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in <t>IL-17–stimulated</t> keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.
    Recombinant Human Il 17a Protein, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/Animal-free+Recombinant+Human+IL-17/pm41418940-69-9-14
    Average 93 stars, based on 1 article reviews
    recombinant human il 17a protein - by Bioz Stars, 2026-09
    93/100 stars
    		  Buy from Supplier
    recombinant human il 17 il 17a protein hz 1113 proteintech  (Proteintech)
    93
    Proteintech recombinant human il 17 il 17a protein hz 1113 proteintech
    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in <t>IL-17–stimulated</t> keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.
    Recombinant Human Il 17 Il 17a Protein Hz 1113 Proteintech, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/Animal-free+Recombinant+Human+IL-17/pmc12575227__DataSheet1-23-16-22
    Average 93 stars, based on 1 article reviews
    recombinant human il 17 il 17a protein hz 1113 proteintech - by Bioz Stars, 2026-09
    93/100 stars
    		  Buy from Supplier
    recombinant human il 17  (R&D Systems)
    93
    R&D Systems recombinant human il 17
    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in <t>IL-17–stimulated</t> keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.
    Recombinant Human Il 17, supplied by R&D Systems, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/Recombinant+Human+IL-17A+(Human+Cell-expressed)+Protein/10__17161_slash_sjm__v2i4__24358-34-2-10
    Average 93 stars, based on 1 article reviews
    recombinant human il 17 - by Bioz Stars, 2026-09
    93/100 stars
    		  Buy from Supplier
    recombinant il 17  (R&D Systems)
    97
    R&D Systems recombinant il 17
    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in <t>IL-17–stimulated</t> keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.
    Recombinant Il 17, supplied by R&D Systems, used in various techniques. Bioz Stars score: 97/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/Recombinant+Human+TNF-alpha+Protein/pmc12466150-41-15-17
    Average 97 stars, based on 1 article reviews
    recombinant il 17 - by Bioz Stars, 2026-09
    97/100 stars
    		  Buy from Supplier
    recombinant cytokines  (Proteintech)
    93
    Proteintech recombinant cytokines
    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in <t>IL-17–stimulated</t> keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.
    Recombinant Cytokines, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/Animal-free+Recombinant+Human+IL-17/pm40381746-137-17-27
    Average 93 stars, based on 1 article reviews
    recombinant cytokines - by Bioz Stars, 2026-09
    93/100 stars
    		  Buy from Supplier
    recombinant human il-17a 200-17 protein  (PeproTech)
    90
    PeproTech recombinant human il-17a 200-17 protein
    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in <t>IL-17–stimulated</t> keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.
    Recombinant Human Il 17a 200 17 Protein, supplied by PeproTech, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/recombinant+human+il+17/ifn+%CE%B3/pmc12184322-70-13-21
    Average 90 stars, based on 1 article reviews
    recombinant human il-17a 200-17 protein - by Bioz Stars, 2026-09
    90/100 stars
    		  Buy from Supplier

    Image Search Results


    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in IL-17–stimulated keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.

    Journal: Frontiers in Pharmacology

    Article Title: Licoisoflavone B alleviates psoriasis via SCD1-targeted lipid metabolism reprogramming and suppression of Th17/IL-17–mediated inflammation

    doi: 10.3389/fphar.2026.1754729

    Figure Lengend Snippet: Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in IL-17–stimulated keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.

    Article Snippet: The IL-17 group was treated with 100 ng/mL IL-17 (Proteintech; HZ-1113); the Lico B group received 9 μM Lico B (MCE; HY-N3388); the IL-17 + Lico B group was co-treated with IL-17 and Lico B; and the control group was treated with PBS.

    Techniques: Biomarker Discovery, In Vitro, In Vivo, Western Blot, Immunofluorescence, Staining, Flow Cytometry

    Schematic illustration of lico B treatment in psoriasis. Lico B modulates lipid metabolic pathways by suppressing SCD1-dependent metabolic reprogramming and reducing lipid droplet accumulation in keratinocyte, while simultaneously attenuating the TH17/IL-17 axis. Through concurrent regulation of keratinocyte metabolism and inflammatory cytokine production, Lico B ameliorate psoriatic skin pathology.

    Journal: Frontiers in Pharmacology

    Article Title: Licoisoflavone B alleviates psoriasis via SCD1-targeted lipid metabolism reprogramming and suppression of Th17/IL-17–mediated inflammation

    doi: 10.3389/fphar.2026.1754729

    Figure Lengend Snippet: Schematic illustration of lico B treatment in psoriasis. Lico B modulates lipid metabolic pathways by suppressing SCD1-dependent metabolic reprogramming and reducing lipid droplet accumulation in keratinocyte, while simultaneously attenuating the TH17/IL-17 axis. Through concurrent regulation of keratinocyte metabolism and inflammatory cytokine production, Lico B ameliorate psoriatic skin pathology.

    Article Snippet: The IL-17 group was treated with 100 ng/mL IL-17 (Proteintech; HZ-1113); the Lico B group received 9 μM Lico B (MCE; HY-N3388); the IL-17 + Lico B group was co-treated with IL-17 and Lico B; and the control group was treated with PBS.

    Techniques:

    Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in IL-17–stimulated keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.

    Journal: Frontiers in Pharmacology

    Article Title: Licoisoflavone B alleviates psoriasis via SCD1-targeted lipid metabolism reprogramming and suppression of Th17/IL-17–mediated inflammation

    doi: 10.3389/fphar.2026.1754729

    Figure Lengend Snippet: Integrated workflow for target prediction and experimental validation of Lico B in psoriasis. Bioinformatic analyses, including WGCNA module construction, gene–trait correlation analysis, multi-database target intersection (GEO, GeneCards, TTD), molecular docking, and SPR analysis were used to identify candidate targets of Lico B. Subsequent in vitro and in vivo experiments—comprising Western blotting, qPCR, immunofluorescence staining, and flow cytometry in IL-17–stimulated keratinocytes and IMQ-induced psoriatic mice—were conducted to validate the therapeutic mechanisms of Lico B.

    Article Snippet: The IL-17 group was treated with 100 ng/mL IL-17 (Proteintech; HZ-1113); the Lico B group received 9 μM Lico B (MCE; HY-N3388); the IL-17 + Lico B group was co-treated with IL-17 and Lico B; and the control group was treated with PBS.

    Techniques: Biomarker Discovery, In Vitro, In Vivo, Western Blot, Immunofluorescence, Staining, Flow Cytometry

    Schematic illustration of lico B treatment in psoriasis. Lico B modulates lipid metabolic pathways by suppressing SCD1-dependent metabolic reprogramming and reducing lipid droplet accumulation in keratinocyte, while simultaneously attenuating the TH17/IL-17 axis. Through concurrent regulation of keratinocyte metabolism and inflammatory cytokine production, Lico B ameliorate psoriatic skin pathology.

    Journal: Frontiers in Pharmacology

    Article Title: Licoisoflavone B alleviates psoriasis via SCD1-targeted lipid metabolism reprogramming and suppression of Th17/IL-17–mediated inflammation

    doi: 10.3389/fphar.2026.1754729

    Figure Lengend Snippet: Schematic illustration of lico B treatment in psoriasis. Lico B modulates lipid metabolic pathways by suppressing SCD1-dependent metabolic reprogramming and reducing lipid droplet accumulation in keratinocyte, while simultaneously attenuating the TH17/IL-17 axis. Through concurrent regulation of keratinocyte metabolism and inflammatory cytokine production, Lico B ameliorate psoriatic skin pathology.

    Article Snippet: The IL-17 group was treated with 100 ng/mL IL-17 (Proteintech; HZ-1113); the Lico B group received 9 μM Lico B (MCE; HY-N3388); the IL-17 + Lico B group was co-treated with IL-17 and Lico B; and the control group was treated with PBS.

    Techniques: